Class a: All alpha proteins [46456] (290 folds) |
Fold a.274: HAMP domain-like [158471] (1 superfamily) dimer of helix-loop-helix segments; distict from the HLH-like fold; parallel four-helical bundle with two overside connections |
Superfamily a.274.1: HAMP domain-like [158472] (1 family) automatically mapped to Pfam PF00672 |
Family a.274.1.1: HAMP domain [158473] (2 proteins) Pfam PF00672 |
Protein automated matches [191239] (1 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [189690] (6 PDB entries) |
Domain d2y0tb_: 2y0t B: [170515] automated match to d2aswa1 mutant |
PDB Entry: 2y0t (more details), 1.3 Å
SCOPe Domain Sequences for d2y0tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2y0tb_ a.274.1.1 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} itrpiielsntfdkiaegnleaevphqnradeigilaksierlrrslkv
Timeline for d2y0tb_: