Lineage for d4crod_ (4cro D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322501Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2322502Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2322523Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2322543Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 2322544Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 2322558Domain d4crod_: 4cro D: [17051]
    CA-atoms only
    protein/DNA complex

Details for d4crod_

PDB Entry: 4cro (more details), 3.9 Å

PDB Description: protein-dna conformational changes in the crystal structure of a lambda cro-operator complex
PDB Compounds: (D:) protein (lambda cro)

SCOPe Domain Sequences for d4crod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crod_ a.35.1.2 (D:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
ktta

SCOPe Domain Coordinates for d4crod_:

Click to download the PDB-style file with coordinates for d4crod_.
(The format of our PDB-style files is described here.)

Timeline for d4crod_: