SCOPe 2.02: Domain d2y0ga_: 2y0g A:

Lineage for d2y0ga_ (2y0g A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (35 PDB entries)

8. Domain d2y0ga_: 2y0g A: [170507]
   automated match to d1qyoa_

Details for d2y0ga_

PDB Entry: 2y0g, 1.5 Å

PDB Description: x-ray structure of enhanced green fluorescent protein (egfp)

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2y0ga_:

Sequence; same for both SEQRES and ATOM records:

>d2y0ga_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d2y0ga_:

• d2y0ga_ first appeared in SCOPe 2.01
  
• d2y0ga_ appears in SCOPe 2.03
  
• d2y0ga_ appears in the current release, SCOPe 2.08