Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein automated matches [190670] (6 species) not a true protein |
Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries) |
Domain d2xzwi_: 2xzw I: [170505] automated match to d1qy7a_ complexed with akg, atp, mg |
PDB Entry: 2xzw (more details), 1.95 Å
SCOPe Domain Sequences for d2xzwi_:
Sequence, based on SEQRES records: (download)
>d2xzwi_ d.58.5.1 (I:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna
>d2xzwi_ d.58.5.1 (I:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]} mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryveflqklkleivve daqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna
Timeline for d2xzwi_: