Lineage for d2xzwh_ (2xzw H:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027295Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1027296Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1027366Protein automated matches [190670] (6 species)
    not a true protein
  7. 1027385Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries)
  8. 1027394Domain d2xzwh_: 2xzw H: [170504]
    automated match to d1qy7a_
    complexed with akg, atp, mg

Details for d2xzwh_

PDB Entry: 2xzw (more details), 1.95 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
PDB Compounds: (H:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xzwh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzwh_ d.58.5.1 (H:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgekna

SCOPe Domain Coordinates for d2xzwh_:

Click to download the PDB-style file with coordinates for d2xzwh_.
(The format of our PDB-style files is described here.)

Timeline for d2xzwh_: