| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
| Protein automated matches [190670] (7 species) not a true protein |
| Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (4 PDB entries) |
| Domain d2xzwg1: 2xzw G:1-112 [170503] Other proteins in same PDB: d2xzwa2, d2xzwb2, d2xzwc2, d2xzwd2, d2xzwf2, d2xzwg2 automated match to d1qy7a_ complexed with akg, atp, mg |
PDB Entry: 2xzw (more details), 1.95 Å
SCOPe Domain Sequences for d2xzwg1:
Sequence, based on SEQRES records: (download)
>d2xzwg1 d.58.5.1 (G:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
>d2xzwg1 d.58.5.1 (G:1-112) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteeytveflqklkleivv
edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadai
Timeline for d2xzwg1: