Lineage for d2xzwf_ (2xzw F:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027295Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1027296Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1027366Protein automated matches [190670] (6 species)
    not a true protein
  7. 1027385Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries)
  8. 1027392Domain d2xzwf_: 2xzw F: [170502]
    automated match to d1qy7a_
    complexed with akg, atp, mg

Details for d2xzwf_

PDB Entry: 2xzw (more details), 1.95 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at low 2-og concentrations
PDB Compounds: (F:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xzwf_:

Sequence, based on SEQRES records: (download)

>d2xzwf_ d.58.5.1 (F:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais

Sequence, based on observed residues (ATOM records): (download)

>d2xzwf_ d.58.5.1 (F:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqterytveflqklkleivv
edaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadais

SCOPe Domain Coordinates for d2xzwf_:

Click to download the PDB-style file with coordinates for d2xzwf_.
(The format of our PDB-style files is described here.)

Timeline for d2xzwf_: