Lineage for d4croc_ (4cro C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2318778Family a.35.1.2: Phage repressors [47419] (7 protein domains)
    consists of different sequence families of HTH repressors of phage origins
  6. 2318798Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 2318799Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 2318812Domain d4croc_: 4cro C: [17050]
    CA-atoms only
    protein/DNA complex

Details for d4croc_

PDB Entry: 4cro (more details), 3.9 Å

PDB Description: protein-dna conformational changes in the crystal structure of a lambda cro-operator complex
PDB Compounds: (C:) protein (lambda cro)

SCOPe Domain Sequences for d4croc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4croc_ a.35.1.2 (C:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
ktta

SCOPe Domain Coordinates for d4croc_:

Click to download the PDB-style file with coordinates for d4croc_.
(The format of our PDB-style files is described here.)

Timeline for d4croc_: