Lineage for d2xyxa_ (2xyx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009606Domain d2xyxa_: 2xyx A: [170490]
    automated match to d1gwxa_
    complexed with bog, z00

Details for d2xyxa_

PDB Entry: 2xyx (more details), 2.7 Å

PDB Description: novel sulfonylthiadiazoles with an unusual binding mode as partial dual peroxisome proliferator-activated receptor (ppar) gamma-delta agonists with high potency and in-vivo efficacy
PDB Compounds: (A:) Peroxisome proliferator-activated receptor delta

SCOPe Domain Sequences for d2xyxa_:

Sequence, based on SEQRES records: (download)

>d2xyxa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkqlvngl
ppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamla
sivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaai
ilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaq
mmqrikktetetslhpllqeiykdm

Sequence, based on observed residues (ATOM records): (download)

>d2xyxa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kafskhiynaylknfnmtkkkarsiltgkapfvihdietlwqaekglvwkqlvnglppyk
eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
drpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqr
ikktetetslhpllqeiykdm

SCOPe Domain Coordinates for d2xyxa_:

Click to download the PDB-style file with coordinates for d2xyxa_.
(The format of our PDB-style files is described here.)

Timeline for d2xyxa_: