SCOPe 2.08: Domain d4crob_: 4cro B:

Lineage for d4crob_ (4cro B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)

8. Domain d4crob_: 4cro B: [17049]
   CA-atoms only
   protein/DNA complex
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d4crob_

PDB Entry: 4cro

PDB Description: protein-dna conformational changes in the crystal structure of a lambda cro-operator complex

PDB Compounds: (B:) protein (lambda cro)

SCOPe Domain Sequences for d4crob_:

Sequence; same for both SEQRES and ATOM records:

>d4crob_ a.35.1.2 (B:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
ktta

Timeline for d4crob_:

• d4crob_ first appeared (with stable ids) in SCOP 1.55
  
• d4crob_ appears in SCOPe 2.07