Lineage for d2xykb_ (2xyk B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2689395Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 2689396Protein automated matches [190590] (26 species)
    not a true protein
  7. 2689402Species Agrobacterium tumefaciens [TaxId:358] [189552] (1 PDB entry)
  8. 2689404Domain d2xykb_: 2xyk B: [170485]
    automated match to d1ux8a_
    complexed with hem

Details for d2xykb_

PDB Entry: 2xyk (more details), 2.1 Å

PDB Description: Group II 2-on-2 Hemoglobin from the Plant Pathogen Agrobacterium tumefaciens
PDB Compounds: (B:) 2-on-2 hemoglobin

SCOPe Domain Sequences for d2xykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xykb_ a.1.1.0 (B:) automated matches {Agrobacterium tumefaciens [TaxId: 358]}
mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy
lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver
lafhmqnqea

SCOPe Domain Coordinates for d2xykb_:

Click to download the PDB-style file with coordinates for d2xykb_.
(The format of our PDB-style files is described here.)

Timeline for d2xykb_: