Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (10 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:358] [189552] (1 PDB entry) |
Domain d2xyka_: 2xyk A: [170484] automated match to d1ux8a_ complexed with hem |
PDB Entry: 2xyk (more details), 2.1 Å
SCOPe Domain Sequences for d2xyka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xyka_ a.1.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 358]} mssetvtlyeaiggdatvraltrrfyelmdtlpeaarcraihpadlsgseakfydyltgy lggppvyvekhghpmlrrrhfvapigpaerdewllcfrramdetienaklreiiwapver lafhmqnqe
Timeline for d2xyka_: