SCOP 1.75: Domain d4croa_: 4cro A:

Lineage for d4croa_ (4cro A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (9 PDB entries)

8. Domain d4croa_: 4cro A: [17048]
   CA-atoms only

Details for d4croa_

PDB Entry: 4cro, 3.9 Å

PDB Description: protein-dna conformational changes in the crystal structure of a lambda cro-operator complex

PDB Compounds: (A:) protein (lambda cro)

SCOP Domain Sequences for d4croa_:

Sequence; same for both SEQRES and ATOM records:

>d4croa_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
qritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfpsnk
ktta

Timeline for d4croa_:

• d4croa_ first appeared (with stable ids) in SCOP 1.55
  
• d4croa_ appears in SCOP 1.73
  
• d4croa_ appears in SCOPe 2.01
  
• d4croa_ appears in the current release, SCOPe 2.08