Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human rhinovirus sp. [TaxId:169066] [189940] (1 PDB entry) |
Domain d2xyaa1: 2xya A:1-180 [170475] Other proteins in same PDB: d2xyaa2 automated match to d1cqqa_ complexed with 7l4 |
PDB Entry: 2xya (more details), 2.4 Å
SCOPe Domain Sequences for d2xyaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xyaa1 b.47.1.4 (A:1-180) 3C cysteine protease (picornain 3C) {Human rhinovirus sp. [TaxId: 169066]} gpeeefgmslikhnscvittengkftglgvydrfvvvpthadpgkeiqvdgittkvidsy dlynkngikleitvlkldrnekfrdirryipnneddypncnlallanqpeptiinvgdvv sygnillsgnqtarmlkysyptksgycggvlykigqvlgihvggngrdgfsamllrsyft
Timeline for d2xyaa1: