SCOPe 2.04: Domain d2xxmb_: 2xxm B:

Lineage for d2xxmb_ (2xxm B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (6 PDB entries)

8. Domain d2xxmb_: 2xxm B: [170472]
   automated match to d2p42b1
   complexed with act

Details for d2xxmb_

PDB Entry: 2xxm, 1.65 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.

PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xxmb_:

Sequence; same for both SEQRES and ATOM records:

>d2xxmb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
lvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvydds
vkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvss

Timeline for d2xxmb_:

• d2xxmb_ first appeared in SCOPe 2.01
  
• d2xxmb_ appears in SCOPe 2.03
  
• d2xxmb_ appears in SCOPe 2.05
  
• d2xxmb_ appears in the current release, SCOPe 2.08, called d2xxmb1