Lineage for d2xxmb1 (2xxm B:4-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2348290Species Vicugna pacos [TaxId:30538] [189756] (42 PDB entries)
  8. 2348293Domain d2xxmb1: 2xxm B:4-112 [170472]
    Other proteins in same PDB: d2xxmb2
    automated match to d2p42b1
    complexed with act

Details for d2xxmb1

PDB Entry: 2xxm (more details), 1.65 Å

PDB Description: crystal structure of the hiv-1 capsid protein c-terminal domain in complex with a camelid vhh and the cai peptide.
PDB Compounds: (B:) camelid vhh 9

SCOPe Domain Sequences for d2xxmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xxmb1 b.1.1.1 (B:4-112) automated matches {Vicugna pacos [TaxId: 30538]}
lvesggglvqaggslrlscaasgsffmsnvmawyrqapgkareliaairggdmstvydds
vkgrftitrdddknilylqmndlkpedtamyyckasgsswgqgtqvtvs

SCOPe Domain Coordinates for d2xxmb1:

Click to download the PDB-style file with coordinates for d2xxmb1.
(The format of our PDB-style files is described here.)

Timeline for d2xxmb1: