SCOPe 2.01: Domain d2xxha_: 2xxh A:

Lineage for d2xxha_ (2xxh A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries)

8. Domain d2xxha_: 2xxh A: [170466]
   automated match to d1lbcb_
   complexed with 1ng, glu, so4, zn

Details for d2xxha_

PDB Entry: 2xxh, 1.5 Å

PDB Description: crystal structure of 1-(4-(2-oxo-2-(1-pyrrolidinyl)ethyl)phenyl)-3-(trifluoromethyl)-4,5,6,7-tetrahydro-1h-indazole in complex with the ligand binding domain of the rat glua2 receptor and glutamate at 1.5a resolution.

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2xxha_:

Sequence; same for both SEQRES and ATOM records:

>d2xxha_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
lseqglldklknkwwydkgecg

Timeline for d2xxha_:

• d2xxha_ is new in SCOPe 2.01-stable
  
• d2xxha_ appears in SCOPe 2.02
  
• d2xxha_ appears in the current release, SCOPe 2.08, called d2xxha1