Lineage for d5crob_ (5cro B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3025Protein cro lambda repressor [47428] (1 species)
  7. 3026Species Bacteriophage lambda (Escherichia coli) [TaxId:10710] [47429] (9 PDB entries)
  8. 3032Domain d5crob_: 5cro B: [17045]

Details for d5crob_

PDB Entry: 5cro (more details), 2.3 Å

PDB Description: refined structure of cro repressor protein from bacteriophage lambda

SCOP Domain Sequences for d5crob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5crob_ a.35.1.2 (B:) cro lambda repressor {Bacteriophage lambda (Escherichia coli)}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
n

SCOP Domain Coordinates for d5crob_:

Click to download the PDB-style file with coordinates for d5crob_.
(The format of our PDB-style files is described here.)

Timeline for d5crob_: