SCOPe 2.08: Domain d2xwsa1: 2xws A:1-125

Lineage for d2xwsa1 (2xws A:1-125)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.3: CbiX-like [110742] (2 proteins)
   Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit

6. Protein automated matches [190267] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187056] (3 PDB entries)

8. Domain d2xwsa1: 2xws A:1-125 [170449]
   Other proteins in same PDB: d2xwsa2
   automated match to d1tjna_

Details for d2xwsa1

PDB Entry: 2xws, 1.6 Å

PDB Description: anaerobic cobalt chelatase (cbix) from archaeoglobus fulgidus

PDB Compounds: (A:) sirohydrochlorin cobaltochelatase

SCOPe Domain Sequences for d2xwsa1:

Sequence; same for both SEQRES and ATOM records:

>d2xwsa1 c.92.1.3 (A:1-125) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
vfrig

Timeline for d2xwsa1:

• d2xwsa1 first appeared in SCOPe 2.01, called d2xwsa_
  
• d2xwsa1 appears in SCOPe 2.07