SCOPe 2.06: Domain d2xwqd_: 2xwq D:

Lineage for d2xwqd_ (2xwq D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.3: CbiX-like [110742] (2 proteins)
   Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit

6. Protein automated matches [190267] (1 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [187056] (3 PDB entries)

8. Domain d2xwqd_: 2xwq D: [170446]
   Other proteins in same PDB: d2xwqa2, d2xwqc2
   automated match to d1tjna_
   complexed with sir

Details for d2xwqd_

PDB Entry: 2xwq, 2.01 Å

PDB Description: anaerobic cobalt chelatase from archeaoglobus fulgidus (cbix) in complex with metalated sirohydrochlorin product

PDB Compounds: (D:) sirohydrochlorin cobaltochelatase

SCOPe Domain Sequences for d2xwqd_:

Sequence; same for both SEQRES and ATOM records:

>d2xwqd_ c.92.1.3 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
vfrig

Timeline for d2xwqd_:

• d2xwqd_ first appeared in SCOPe 2.01
  
• d2xwqd_ appears in SCOPe 2.05
  
• d2xwqd_ appears in SCOPe 2.07
  
• d2xwqd_ appears in the current release, SCOPe 2.08