Lineage for d2xwqa1 (2xwq A:1-125)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912329Family c.92.1.3: CbiX-like [110742] (2 proteins)
    Pfam PF01903; single-domain protein; forms the C-terminal helix-swapped dimer similar to the CbiK subunit
  6. 2912333Protein automated matches [190267] (1 species)
    not a true protein
  7. 2912334Species Archaeoglobus fulgidus [TaxId:2234] [187056] (3 PDB entries)
  8. 2912336Domain d2xwqa1: 2xwq A:1-125 [170443]
    Other proteins in same PDB: d2xwqa2, d2xwqc2
    automated match to d1tjna_
    complexed with sir

Details for d2xwqa1

PDB Entry: 2xwq (more details), 2.01 Å

PDB Description: anaerobic cobalt chelatase from archeaoglobus fulgidus (cbix) in complex with metalated sirohydrochlorin product
PDB Compounds: (A:) sirohydrochlorin cobaltochelatase

SCOPe Domain Sequences for d2xwqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwqa1 c.92.1.3 (A:1-125) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mrrglvivghgsqlnhyrevmelhrkrieesgafdevkiafaarkrrpmpdeairemncd
iiyvvplfisyglhvtedlpdllgfprgrgikegefegkkvvicepigedyfvtyailns
vfrig

SCOPe Domain Coordinates for d2xwqa1:

Click to download the PDB-style file with coordinates for d2xwqa1.
(The format of our PDB-style files is described here.)

Timeline for d2xwqa1: