![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.2: Cobalt chelatase CbiK [53804] (2 proteins) automatically mapped to Pfam PF06180 |
![]() | Protein automated matches [191214] (1 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [189581] (1 PDB entry) |
![]() | Domain d2xwpa_: 2xwp A: [170442] automated match to d1qgoa_ complexed with gol, sir |
PDB Entry: 2xwp (more details), 1.9 Å
SCOPe Domain Sequences for d2xwpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xwpa_ c.92.1.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]} kkallvvsfgtsyhdtceknivacerdlaascpdrdlfraftsgmiirklrqrdgididt plqalqklaaqgyqdvaiqslhiingdeyekivrevqllrplftrltlgvpllsshndyv qlmqalrqqmpslrqtekvvfmghgashhafaayacldhmmtaqrfparvgavesypevd ilidslrdegvtgvhlmplmlvagdhaindmasddgdswkmrfnaagipatpwlsglgen pairamfvahlhqalnm
Timeline for d2xwpa_: