Lineage for d2xwpa_ (2xwp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912238Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 2912322Family c.92.1.2: Cobalt chelatase CbiK [53804] (2 proteins)
    automatically mapped to Pfam PF06180
  6. 2912326Protein automated matches [191214] (1 species)
    not a true protein
  7. 2912327Species Salmonella typhimurium [TaxId:90371] [189581] (1 PDB entry)
  8. 2912328Domain d2xwpa_: 2xwp A: [170442]
    automated match to d1qgoa_
    complexed with gol, sir

Details for d2xwpa_

PDB Entry: 2xwp (more details), 1.9 Å

PDB Description: anaerobic cobalt chelatase (cbik) from salmonella typhimurium in complex with metalated tetrapyrrole
PDB Compounds: (A:) sirohydrochlorin cobaltochelatase

SCOPe Domain Sequences for d2xwpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwpa_ c.92.1.2 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
kkallvvsfgtsyhdtceknivacerdlaascpdrdlfraftsgmiirklrqrdgididt
plqalqklaaqgyqdvaiqslhiingdeyekivrevqllrplftrltlgvpllsshndyv
qlmqalrqqmpslrqtekvvfmghgashhafaayacldhmmtaqrfparvgavesypevd
ilidslrdegvtgvhlmplmlvagdhaindmasddgdswkmrfnaagipatpwlsglgen
pairamfvahlhqalnm

SCOPe Domain Coordinates for d2xwpa_:

Click to download the PDB-style file with coordinates for d2xwpa_.
(The format of our PDB-style files is described here.)

Timeline for d2xwpa_: