Lineage for d2xwnb1 (2xwn B:5-229)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150446Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2150447Protein automated matches [190951] (26 species)
    not a true protein
  7. 2150536Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries)
  8. 2150549Domain d2xwnb1: 2xwn B:5-229 [170441]
    Other proteins in same PDB: d2xwna2, d2xwnb2
    automated match to d1vpaa_
    complexed with ctp, mg

Details for d2xwnb1

PDB Entry: 2xwn (more details), 2.9 Å

PDB Description: crystal structure of ispd from mycobacterium tuberculosis in complex with ctp and mg
PDB Compounds: (B:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d2xwnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xwnb1 c.68.1.0 (B:5-229) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
agevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtd
earqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvvea
lrdgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsld
lpaaeytddaslvehiggqvqvvdgdplafkittkldlllaqaiv

SCOPe Domain Coordinates for d2xwnb1:

Click to download the PDB-style file with coordinates for d2xwnb1.
(The format of our PDB-style files is described here.)

Timeline for d2xwnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xwnb2