Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.0: automated matches [191551] (1 protein) not a true family |
Protein automated matches [190951] (26 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [189483] (7 PDB entries) |
Domain d2xwnb1: 2xwn B:5-229 [170441] Other proteins in same PDB: d2xwna2, d2xwnb2 automated match to d1vpaa_ complexed with ctp, mg |
PDB Entry: 2xwn (more details), 2.9 Å
SCOPe Domain Sequences for d2xwnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xwnb1 c.68.1.0 (B:5-229) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} agevvaivpaagsgerlavgvpkafyqldgqtlieravdglldsgvvdtvvvavpadrtd earqilghramivaggsnrtdtvnlaltvlsgtaepefvlvhdaaraltppalvarvvea lrdgyaavvpvlplsdtikavdangvvlgtperaglravqtpqgfttdlllrsyqrgsld lpaaeytddaslvehiggqvqvvdgdplafkittkldlllaqaiv
Timeline for d2xwnb1: