Lineage for d2xwca1 (2xwc A:112-311)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034243Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2034244Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 protein domains)
  6. 2034349Protein automated matches [190198] (2 species)
    not a true protein
  7. 2034350Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2034398Domain d2xwca1: 2xwc A:112-311 [170438]
    Other proteins in same PDB: d2xwca2
    automated match to d1gzha_
    complexed with gol, tam, zn

Details for d2xwca1

PDB Entry: 2xwc (more details), 1.82 Å

PDB Description: Crystal structure of the DNA binding domain of human TP73 refined at 1.8 A resolution
PDB Compounds: (A:) tumour protein p73

SCOPe Domain Sequences for d2xwca1:

Sequence, based on SEQRES records: (download)

>d2xwca1 b.2.5.2 (A:112-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfe
gricacpgrdrkadedhyre

Sequence, based on observed residues (ATOM records): (download)

>d2xwca1 b.2.5.2 (A:112-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apvipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstpppp
gtairampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvt
grqsvvvpyeppqvgtefttilynfmcnsscvgrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyre

SCOPe Domain Coordinates for d2xwca1:

Click to download the PDB-style file with coordinates for d2xwca1.
(The format of our PDB-style files is described here.)

Timeline for d2xwca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xwca2