Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) contains a common phosphate-binding site |
Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins) |
Protein automated matches [191238] (1 species) not a true protein |
Species Thermus sp. [TaxId:405418] [189683] (2 PDB entries) |
Domain d2xw6c_: 2xw6 C: [170435] Other proteins in same PDB: d2xw6a2, d2xw6b2 automated match to d1wo8a1 complexed with po4 |
PDB Entry: 2xw6 (more details), 1.08 Å
SCOPe Domain Sequences for d2xw6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xw6c_ c.24.1.2 (C:) automated matches {Thermus sp. [TaxId: 405418]} mralaliahdakkeemvafcqrhrevlarfplvatgttgrrieeatgltvekllsgplgg dqqmgarvaegrilaviffrdpltaqphepdvqallrvcdvhgvplatnpmaaealipwl qslv
Timeline for d2xw6c_:
View in 3D Domains from other chains: (mouse over for more information) d2xw6a1, d2xw6a2, d2xw6b1, d2xw6b2 |