Lineage for d2xw6c_ (2xw6 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859610Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2859650Protein automated matches [191238] (1 species)
    not a true protein
  7. 2859651Species Thermus sp. [TaxId:405418] [189683] (2 PDB entries)
  8. 2859654Domain d2xw6c_: 2xw6 C: [170435]
    Other proteins in same PDB: d2xw6a2, d2xw6b2
    automated match to d1wo8a1
    complexed with po4

Details for d2xw6c_

PDB Entry: 2xw6 (more details), 1.08 Å

PDB Description: the crystal structure of methylglyoxal synthase from thermus sp. gh5 bound to phosphate ion.
PDB Compounds: (C:) methylglyoxal synthase

SCOPe Domain Sequences for d2xw6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xw6c_ c.24.1.2 (C:) automated matches {Thermus sp. [TaxId: 405418]}
mralaliahdakkeemvafcqrhrevlarfplvatgttgrrieeatgltvekllsgplgg
dqqmgarvaegrilaviffrdpltaqphepdvqallrvcdvhgvplatnpmaaealipwl
qslv

SCOPe Domain Coordinates for d2xw6c_:

Click to download the PDB-style file with coordinates for d2xw6c_.
(The format of our PDB-style files is described here.)

Timeline for d2xw6c_: