SCOPe 2.01: Domain d2xw6b_: 2xw6 B:

Lineage for d2xw6b_ (2xw6 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)
   contains a common phosphate-binding site

5. Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)

6. Protein automated matches [191238] (1 species)
   not a true protein

7. Species Thermus sp. [TaxId:405418] [189683] (2 PDB entries)

8. Domain d2xw6b_: 2xw6 B: [170434]
   automated match to d1wo8a1
   complexed with po4

Details for d2xw6b_

PDB Entry: 2xw6, 1.08 Å

PDB Description: the crystal structure of methylglyoxal synthase from thermus sp. gh5 bound to phosphate ion.

PDB Compounds: (B:) methylglyoxal synthase

SCOPe Domain Sequences for d2xw6b_:

Sequence; same for both SEQRES and ATOM records:

>d2xw6b_ c.24.1.2 (B:) automated matches {Thermus sp. [TaxId: 405418]}
shmralaliahdakkeemvafcqrhrevlarfplvatgttgrrieeatgltvekllsgpl
ggdqqmgarvaegrilaviffrdpltaqphepdvqallrvcdvhgvplatnpmaaealip
wlqslvg

Timeline for d2xw6b_:

• d2xw6b_ is new in SCOPe 2.01-stable
  
• d2xw6b_ appears in SCOPe 2.02
  
• d2xw6b_ appears in the current release, SCOPe 2.08, called d2xw6b1