Lineage for d2xvza_ (2xvz A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1389887Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1389888Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1389980Family c.92.1.0: automated matches [191654] (1 protein)
    not a true family
  6. 1389981Protein automated matches [191213] (1 species)
    not a true protein
  7. 1389982Species Desulfovibrio vulgaris [TaxId:882] [189580] (3 PDB entries)
  8. 1389985Domain d2xvza_: 2xvz A: [170432]
    automated match to d1qgoa_
    complexed with cl, co, gol, hem, na, per, so4

Details for d2xvza_

PDB Entry: 2xvz (more details), 2.4 Å

PDB Description: cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (co-crystallized with cobalt)
PDB Compounds: (A:) chelatase, putative

SCOPe Domain Sequences for d2xvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvza_ c.92.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
aqktgillvafgtsveearpaldkmgdrvraahpdipvrwaytakmiraklraegiaaps
paealagmaeegfthvavqslhtipgeefhglletahafqglpkgltrvsvglpligtta
daeavaealvaslpadrkpgepvvfmghgtphpadicypglqyylwrldpdllvgtvegs
psfdnvmaeldvrkakrvwlmplmavagdharndmagdeddswtsqlarrgieakpvlhg
taesdavaaiwlrhlddalarln

SCOPe Domain Coordinates for d2xvza_:

Click to download the PDB-style file with coordinates for d2xvza_.
(The format of our PDB-style files is described here.)

Timeline for d2xvza_: