![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.92.1: Chelatase [53800] (4 families) ![]() interdomain linker is short; swapping of C-terminal helices between the two domains |
![]() | Family c.92.1.0: automated matches [191654] (1 protein) not a true family |
![]() | Protein automated matches [191213] (1 species) not a true protein |
![]() | Species Desulfovibrio vulgaris [TaxId:882] [189580] (3 PDB entries) |
![]() | Domain d2xvya_: 2xvy A: [170431] automated match to d1qgoa_ complexed with co, gol, hem, na, per, so4 |
PDB Entry: 2xvy (more details), 1.7 Å
SCOPe Domain Sequences for d2xvya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xvya_ c.92.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]} qktgillvafgtsveearpaldkmgdrvraahpdipvrwaytakmiraklraegiaapsp aealagmaeegfthvavqslhtipgeefhglletahafqglpkgltrvsvglpligttad aeavaealvaslpadrkpgepvvfmghgtphpadicypglqyylwrldpdllvgtvegsp sfdnvmaeldvrkakrvwlmplmavagdharndmagdeddswtsqlarrgieakpvlhgt aesdavaaiwlrhlddalarln
Timeline for d2xvya_: