Lineage for d2xvxa_ (2xvx A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008175Family c.92.1.0: automated matches [191654] (1 protein)
    not a true family
  6. 1008176Protein automated matches [191213] (1 species)
    not a true protein
  7. 1008177Species Desulfovibrio vulgaris [TaxId:882] [189580] (3 PDB entries)
  8. 1008179Domain d2xvxa_: 2xvx A: [170430]
    automated match to d1qgoa_
    complexed with cl, co2, gol, hem, na, so4

Details for d2xvxa_

PDB Entry: 2xvx (more details), 1.9 Å

PDB Description: cobalt chelatase cbik (periplasmatic) from desulvobrio vulgaris hildenborough (native)
PDB Compounds: (A:) chelatase, putative

SCOPe Domain Sequences for d2xvxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvxa_ c.92.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]}
qktgillvafgtsveearpaldkmgdrvraahpdipvrwaytakmiraklraegiaapsp
aealagmaeegfthvavqslhtipgeefhglletahafqglpkgltrvsvglpligttad
aeavaealvaslpadrkpgepvvfmghgtphpadicypglqyylwrldpdllvgtvegsp
sfdnvmaeldvrkakrvwlmplmavagdharndmagdeddswtsqlarrgieakpvlhgt
aesdavaaiwlrhlddalarln

SCOPe Domain Coordinates for d2xvxa_:

Click to download the PDB-style file with coordinates for d2xvxa_.
(The format of our PDB-style files is described here.)

Timeline for d2xvxa_: