Lineage for d5croo_ (5cro O:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1995687Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1995688Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1995709Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 1995729Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 1995730Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 1995738Domain d5croo_: 5cro O: [17043]
    complexed with po4

Details for d5croo_

PDB Entry: 5cro (more details), 2.3 Å

PDB Description: refined structure of cro repressor protein from bacteriophage lambda
PDB Compounds: (O:) cro repressor protein

SCOPe Domain Sequences for d5croo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5croo_ a.35.1.2 (O:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps

SCOPe Domain Coordinates for d5croo_:

Click to download the PDB-style file with coordinates for d5croo_.
(The format of our PDB-style files is described here.)

Timeline for d5croo_: