Lineage for d2xvpb1 (2xvp B:29-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832404Species Aspergillus fumigatus [TaxId:451804] [189778] (3 PDB entries)
  8. 2832406Domain d2xvpb1: 2xvp B:29-337 [170429]
    Other proteins in same PDB: d2xvpa2, d2xvpb2
    automated match to d1hvqa_
    complexed with po4

Details for d2xvpb1

PDB Entry: 2xvp (more details), 2 Å

PDB Description: chia1 from aspergillus fumigatus, apostructure
PDB Compounds: (B:) class III chitinase chia1

SCOPe Domain Sequences for d2xvpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xvpb1 c.1.8.0 (B:29-337) automated matches {Aspergillus fumigatus [TaxId: 451804]}
snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
dhmkdillh

SCOPe Domain Coordinates for d2xvpb1:

Click to download the PDB-style file with coordinates for d2xvpb1.
(The format of our PDB-style files is described here.)

Timeline for d2xvpb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2xvpb2