SCOPe 2.08: Domain d2xvpa1: 2xvp A:29-337

Lineage for d2xvpa1 (2xvp A:29-337)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (132 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:451804] [189778] (3 PDB entries)

8. Domain d2xvpa1: 2xvp A:29-337 [170428]
   Other proteins in same PDB: d2xvpa2, d2xvpb2
   automated match to d1hvqa_
   complexed with po4

Details for d2xvpa1

PDB Entry: 2xvp, 2 Å

PDB Description: chia1 from aspergillus fumigatus, apostructure

PDB Compounds: (A:) class III chitinase chia1

SCOPe Domain Sequences for d2xvpa1:

Sequence; same for both SEQRES and ATOM records:

>d2xvpa1 c.1.8.0 (A:29-337) automated matches {Aspergillus fumigatus [TaxId: 451804]}
snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
dhmkdillh

Timeline for d2xvpa1:

• d2xvpa1 first appeared in SCOPe 2.01, called d2xvpa_
  
• d2xvpa1 appears in SCOPe 2.07