SCOPe 2.05: Domain d2xvmb_: 2xvm B:

Lineage for d2xvmb_ (2xvm B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.44: TehB-like [142603] (2 proteins)
   Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)

6. Protein automated matches [191226] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189643] (2 PDB entries)

8. Domain d2xvmb_: 2xvm B: [170424]
   automated match to d2i6ga1
   complexed with sah

Details for d2xvmb_

PDB Entry: 2xvm, 1.48 Å

PDB Description: crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah

PDB Compounds: (B:) tellurite resistance protein tehb

SCOPe Domain Sequences for d2xvmb_:

Sequence; same for both SEQRES and ATOM records:

>d2xvmb_ c.66.1.44 (B:) automated matches {Escherichia coli [TaxId: 562]}
rdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdknam
sianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianmqrc
tkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtdangn
riklrfatmlarkk

Timeline for d2xvmb_:

• d2xvmb_ first appeared in SCOPe 2.01
  
• d2xvmb_ appears in SCOPe 2.04
  
• d2xvmb_ appears in SCOPe 2.06
  
• d2xvmb_ appears in the current release, SCOPe 2.08