Lineage for d2xvac_ (2xva C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130322Family c.66.1.44: TehB-like [142603] (2 protein domains)
    Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)
  6. 2130327Protein automated matches [191226] (3 species)
    not a true protein
  7. 2130330Species Escherichia coli [TaxId:511145] [189644] (1 PDB entry)
  8. 2130333Domain d2xvac_: 2xva C: [170421]
    Other proteins in same PDB: d2xvaa2, d2xvab2
    automated match to d2i6ga1
    complexed with sfg, zn

Details for d2xvac_

PDB Entry: 2xva (more details), 1.9 Å

PDB Description: Crystal structure of the tellurite detoxification protein TehB from E. coli in complex with sinefungin
PDB Compounds: (C:) tellurite resistance protein tehb

SCOPe Domain Sequences for d2xvac_:

Sequence, based on SEQRES records: (download)

>d2xvac_ c.66.1.44 (C:) automated matches {Escherichia coli [TaxId: 511145]}
rdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdknam
sianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianmqrc
tkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtdangn
riklrfatmlark

Sequence, based on observed residues (ATOM records): (download)

>d2xvac_ c.66.1.44 (C:) automated matches {Escherichia coli [TaxId: 511145]}
rdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdknam
sianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianmqrc
tkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtdnrik
lrfatmlark

SCOPe Domain Coordinates for d2xvac_:

Click to download the PDB-style file with coordinates for d2xvac_.
(The format of our PDB-style files is described here.)

Timeline for d2xvac_: