SCOPe 2.08: Domain d2xvab1: 2xva B:1-197

Lineage for d2xvab1 (2xva B:1-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.44: TehB-like [142603] (2 proteins)
   Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)

6. Protein automated matches [191226] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [189644] (1 PDB entry)

8. Domain d2xvab1: 2xva B:1-197 [170420]
   Other proteins in same PDB: d2xvaa2, d2xvab2
   automated match to d2i6ga1
   complexed with sfg, zn

Details for d2xvab1

PDB Entry: 2xva, 1.9 Å

PDB Description: Crystal structure of the tellurite detoxification protein TehB from E. coli in complex with sinefungin

PDB Compounds: (B:) tellurite resistance protein tehb

SCOPe Domain Sequences for d2xvab1:

Sequence; same for both SEQRES and ATOM records:

>d2xvab1 c.66.1.44 (B:1-197) automated matches {Escherichia coli [TaxId: 511145]}
mvirdenyftdkyeltrthsevleavkvvkpgktldlgcgngrnslylaangydvdawdk
namsianveriksienldnlhtrvvdlnnltfdrqydfilstvvlmfleaktipglianm
qrctkpggynlivaamdtadypctvgfpfafkegelrryyegwervkynedvgelhrtda
ngnriklrfatmlarkk

Timeline for d2xvab1:

• d2xvab1 first appeared in SCOPe 2.01, called d2xvab_
  
• d2xvab1 appears in SCOPe 2.07