SCOP 1.71: Domain d1adr__: 1adr -

Lineage for d1adr__ (1adr -)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein P22 C2 repressor, DNA-binding domain [47426] (1 species)

7. Species Salmonella bacteriophage P22 [TaxId:10754] [47427] (1 PDB entry)
   contains a short additional helix at C-terminus

8. Domain d1adr__: 1adr - [17042]

Details for d1adr__

PDB Entry: 1adr

PDB Description: determination of the nuclear magnetic resonance structure of the dna-binding domain of the p22 c2 repressor (1-76) in solution and comparison with the dna-binding domain of the 434 repressor

SCOP Domain Sequences for d1adr__:

Sequence; same for both SEQRES and ATOM records:

>d1adr__ a.35.1.2 (-) P22 C2 repressor, DNA-binding domain {Salmonella bacteriophage P22}
mntqlmgerirarrkklkirqaalgkmvgvsnvaisqwersetepngenllalskalqcs
pdyllkgdlsqtnvay

Timeline for d1adr__:

• d1adr__ first appeared (with stable ids) in SCOP 1.55
  
• d1adr__ appears in SCOP 1.69
  
• d1adr__ is called d1adra_ in SCOP 1.73
  
• d1adr__ appears in the current release, SCOPe 2.08, called d1adra_