SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2xuqb_ (2xuq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2134368Species Mouse (Mus musculus) [TaxId:10090] [187006] (55 PDB entries)
  8. 2134454Domain d2xuqb_: 2xuq B: [170412]
    automated match to d1maac_
    complexed with p6g, tz4; mutant

Details for d2xuqb_

PDB Entry: 2xuq (more details), 2.7 Å

PDB Description: crystal structure of the mache-y337a mutant in complex with soaked tz2pa6 anti-syn inhibitors
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d2xuqb_:

Sequence, based on SEQRES records: (download)

>d2xuqb_ c.69.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls

Sequence, based on observed residues (ATOM records): (download)

>d2xuqb_ c.69.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcpndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdfls
dtpealintgdfqdlqvlvgvvkdegsaflvygvpgfskdneslisraqflagvrigvpq
asdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayi
fehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdp
ndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpklls

SCOPe Domain Coordinates for d2xuqb_:

Click to download the PDB-style file with coordinates for d2xuqb_.
(The format of our PDB-style files is described here.)

Timeline for d2xuqb_: