Lineage for d1zuga_ (1zug A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913577Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 913578Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 913599Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 913613Protein cro 434 [47424] (1 species)
  7. 913614Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
    contains a short additional helix at C-terminus
  8. 913618Domain d1zuga_: 1zug A: [17041]

Details for d1zuga_

PDB Entry: 1zug (more details)

PDB Description: structure of phage 434 cro protein, nmr, 20 structures
PDB Compounds: (A:) phage 434 cro protein

SCOPe Domain Sequences for d1zuga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zuga_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtkrgkaa

SCOPe Domain Coordinates for d1zuga_:

Click to download the PDB-style file with coordinates for d1zuga_.
(The format of our PDB-style files is described here.)

Timeline for d1zuga_: