Lineage for d1zug__ (1zug -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537290Protein cro 434 [47424] (1 species)
  7. 537291Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
    contains a short additional helix at C-terminus
  8. 537295Domain d1zug__: 1zug - [17041]

Details for d1zug__

PDB Entry: 1zug (more details)

PDB Description: structure of phage 434 cro protein, nmr, 20 structures

SCOP Domain Sequences for d1zug__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zug__ a.35.1.2 (-) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtkrgkaa

SCOP Domain Coordinates for d1zug__:

Click to download the PDB-style file with coordinates for d1zug__.
(The format of our PDB-style files is described here.)

Timeline for d1zug__: