Lineage for d1zug__ (1zug -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47323Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 47324Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 47337Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 47350Protein cro 434 [47424] (1 species)
  7. 47351Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
  8. 47355Domain d1zug__: 1zug - [17041]

Details for d1zug__

PDB Entry: 1zug (more details)

PDB Description: structure of phage 434 cro protein, nmr, 20 structures

SCOP Domain Sequences for d1zug__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zug__ a.35.1.2 (-) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtkrgkaa

SCOP Domain Coordinates for d1zug__:

Click to download the PDB-style file with coordinates for d1zug__.
(The format of our PDB-style files is described here.)

Timeline for d1zug__: