SCOPe 2.01: Domain d2xuld_: 2xul D:

Lineage for d2xuld_ (2xul D:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries)

8. Domain d2xuld_: 2xul D: [170403]
   automated match to d1qy7a_
   complexed with akg, atp, mg

Details for d2xuld_

PDB Entry: 2xul, 2.2 Å

PDB Description: structure of pii from synechococcus elongatus in complex with 2-oxoglutarate at high 2-og concentrations

PDB Compounds: (D:) nitrogen regulatory protein p-II

SCOPe Domain Sequences for d2xuld_:

Sequence, based on SEQRES records:

>d2xuld_ d.58.5.1 (D:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisa

Sequence, based on observed residues (ATOM records):

>d2xuld_ d.58.5.1 (D:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqytveflqklkleivveda
qvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisa

Timeline for d2xuld_:

• d2xuld_ is new in SCOPe 2.01-stable
  
• d2xuld_ appears in SCOPe 2.02
  
• d2xuld_ appears in the current release, SCOPe 2.08, called d2xuld1