| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) ![]() form timeric structures with the orthogonally packed beta-sheets |
| Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
| Protein automated matches [190670] (6 species) not a true protein |
| Species Synechococcus elongatus PCC 7942 [TaxId:1140] [189437] (3 PDB entries) |
| Domain d2xuld_: 2xul D: [170403] automated match to d1qy7a_ complexed with akg, atp, mg |
PDB Entry: 2xul (more details), 2.2 Å
SCOPe Domain Sequences for d2xuld_:
Sequence, based on SEQRES records: (download)
>d2xuld_ d.58.5.1 (D:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqteryrgseytveflqklk
leivvedaqvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisa
>d2xuld_ d.58.5.1 (D:) automated matches {Synechococcus elongatus PCC 7942 [TaxId: 1140]}
mkkieaiirpfkldevkialvnagivgmtvsevrgfgrqkgqytveflqklkleivveda
qvdtvidkivaaartgeigdgkifvspvdqtirirtgeknadaisa
Timeline for d2xuld_: