SCOPe 2.01: Domain d3crol_: 3cro L:

Lineage for d3crol_ (3cro L:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro 434 [47424] (1 species)

7. Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
   contains a short additional helix at C-terminus

8. Domain d3crol_: 3cro L: [17039]
   protein/DNA complex

Details for d3crol_

PDB Entry: 3cro, 2.5 Å

PDB Description: the phage 434 cro/or1 complex at 2.5 angstroms resolution

PDB Compounds: (L:) protein (434 cro)

SCOPe Domain Sequences for d3crol_:

Sequence; same for both SEQRES and ATOM records:

>d3crol_ a.35.1.2 (L:) cro 434 {Bacteriophage 434 [TaxId: 10712]}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtk

Timeline for d3crol_:

• d3crol_ first appeared (with stable ids) in SCOP 1.55
  
• d3crol_ appears in SCOP 1.75
  
• d3crol_ appears in SCOPe 2.02
  
• d3crol_ appears in the current release, SCOPe 2.08