Lineage for d3crol_ (3cro L:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537290Protein cro 434 [47424] (1 species)
  7. 537291Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
    contains a short additional helix at C-terminus
  8. 537293Domain d3crol_: 3cro L: [17039]

Details for d3crol_

PDB Entry: 3cro (more details), 2.5 Å

PDB Description: the phage 434 cro/or1 complex at 2.5 angstroms resolution

SCOP Domain Sequences for d3crol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crol_ a.35.1.2 (L:) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtk

SCOP Domain Coordinates for d3crol_:

Click to download the PDB-style file with coordinates for d3crol_.
(The format of our PDB-style files is described here.)

Timeline for d3crol_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3cror_