Lineage for d3crol_ (3cro L:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3019Protein cro 434 [47424] (1 species)
  7. 3020Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
  8. Domain d3crol_: 3cro L: [17039]

Details for d3crol_

PDB Entry: 3cro (more details), 2.5 Å

PDB Description: the phage 434 cro/or1 complex at 2.5 angstroms resolution

SCOP Domain Sequences for d3crol_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crol_ a.35.1.2 (L:) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygtk

SCOP Domain Coordinates for d3crol_ are not available.

Timeline for d3crol_:

Domains from other chains:
(mouse over for more information)
d3cror_