Lineage for d2xucc_ (2xuc C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 971534Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 971535Protein automated matches [190075] (16 species)
    not a true protein
  7. 971550Species Aspergillus fumigatus [TaxId:5085] [189545] (2 PDB entries)
  8. 971553Domain d2xucc_: 2xuc C: [170385]
    automated match to d1hvqa_
    complexed with cl, po4, xrg

Details for d2xucc_

PDB Entry: 2xuc (more details), 2.3 Å

PDB Description: natural product-guided discovery of a fungal chitinase inhibitor
PDB Compounds: (C:) chitinase

SCOPe Domain Sequences for d2xucc_:

Sequence, based on SEQRES records: (download)

>d2xucc_ c.1.8.0 (C:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyv
tndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwga
fgpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapq
ciipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskda
klyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapy
adhmkdill

Sequence, based on observed residues (ATOM records): (download)

>d2xucc_ c.1.8.0 (C:) automated matches {Aspergillus fumigatus [TaxId: 5085]}
fsnlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgncgsvyvtn
dgvvtksgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgafgpp
rpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnerkfylsaapqciipdaqlsdaifn
aafdfiwiqyyntaacsaksfidtlgtfnfdawvtvlkasaskdaklyvglpasetanqg
yyltpdeveslvstymdrypdtfggimlweatasennqidgapyadhmkdill

SCOPe Domain Coordinates for d2xucc_:

Click to download the PDB-style file with coordinates for d2xucc_.
(The format of our PDB-style files is described here.)

Timeline for d2xucc_: