Lineage for d2xucb1 (2xuc B:29-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832411Species Aspergillus fumigatus [TaxId:5085] [189545] (2 PDB entries)
  8. 2832416Domain d2xucb1: 2xuc B:29-337 [170384]
    Other proteins in same PDB: d2xuca2, d2xucb2, d2xucc2
    automated match to d1hvqa_
    complexed with cl, po4, xrg

Details for d2xucb1

PDB Entry: 2xuc (more details), 2.3 Å

PDB Description: natural product-guided discovery of a fungal chitinase inhibitor
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d2xucb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xucb1 c.1.8.0 (B:29-337) automated matches {Aspergillus fumigatus [TaxId: 5085]}
snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
dhmkdillh

SCOPe Domain Coordinates for d2xucb1:

Click to download the PDB-style file with coordinates for d2xucb1.
(The format of our PDB-style files is described here.)

Timeline for d2xucb1: