Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Aspergillus fumigatus [TaxId:5085] [189545] (2 PDB entries) |
Domain d2xuca1: 2xuc A:29-337 [170383] Other proteins in same PDB: d2xuca2, d2xucb2, d2xucc2 automated match to d1hvqa_ complexed with cl, po4, xrg |
PDB Entry: 2xuc (more details), 2.3 Å
SCOPe Domain Sequences for d2xuca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xuca1 c.1.8.0 (A:29-337) automated matches {Aspergillus fumigatus [TaxId: 5085]} snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya dhmkdillh
Timeline for d2xuca1:
View in 3D Domains from other chains: (mouse over for more information) d2xucb1, d2xucb2, d2xucc1, d2xucc2 |