Class a: All alpha proteins [46456] (289 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein cro 434 [47424] (1 species) |
Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries) contains a short additional helix at C-terminus |
Domain d2croa_: 2cro A: [17038] |
PDB Entry: 2cro (more details), 2.35 Å
SCOPe Domain Sequences for d2croa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2croa_ a.35.1.2 (A:) cro 434 {Bacteriophage 434 [TaxId: 10712]} mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw lqygt
Timeline for d2croa_: