Lineage for d2cro__ (2cro -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537254Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 537255Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (8 families) (S)
  5. 537276Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 537290Protein cro 434 [47424] (1 species)
  7. 537291Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
    contains a short additional helix at C-terminus
  8. 537292Domain d2cro__: 2cro - [17038]

Details for d2cro__

PDB Entry: 2cro (more details), 2.35 Å

PDB Description: structure of phage 434 cro protein at 2.35 angstroms resolution

SCOP Domain Sequences for d2cro__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cro__ a.35.1.2 (-) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygt

SCOP Domain Coordinates for d2cro__:

Click to download the PDB-style file with coordinates for d2cro__.
(The format of our PDB-style files is described here.)

Timeline for d2cro__: