Lineage for d2cro__ (2cro -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2993Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
  4. 2994Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (5 families) (S)
  5. 3006Family a.35.1.2: Phage repressors [47419] (6 proteins)
  6. 3019Protein cro 434 [47424] (1 species)
  7. 3020Species Bacteriophage 434 [TaxId:10712] [47425] (3 PDB entries)
  8. 3021Domain d2cro__: 2cro - [17038]

Details for d2cro__

PDB Entry: 2cro (more details), 2.35 Å

PDB Description: structure of phage 434 cro protein at 2.35 angstroms resolution

SCOP Domain Sequences for d2cro__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cro__ a.35.1.2 (-) cro 434 {Bacteriophage 434}
mqtlserlkkrrialkmtqtelatkagvkqqsiqlieagvtkrprflfeiamalncdpvw
lqygt

SCOP Domain Coordinates for d2cro__:

Click to download the PDB-style file with coordinates for d2cro__.
(The format of our PDB-style files is described here.)

Timeline for d2cro__: